PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc01683.1.g00010.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRF
Protein Properties Length: 163aa    MW: 18076.7 Da    PI: 9.7418
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc01683.1.g00010.1.am.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC71.31.2e-2281125145
                             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                                     ++epgrCrRtDGKkWRC+r +++++k+C+rH+hrgr+r  + ++e
  Zjn_sc01683.1.g00010.1.am.mkhc  81 EPEPGRCRRTDGKKWRCWRSTIPNEKYCQRHMHRGRKRPVQLVVE 125
                                     69************************************9998875 PP

2QLQ53.95.5e-191550237
                             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                                     FTa+Qlq+L++Q  +y+y+aa++PvP +L+++i+k
  Zjn_sc01683.1.g00010.1.am.mkhc 15 LFTAMQLQELEQQSRVYQYMAARVPVPTHLVFPIWK 50
                                    6**********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.0E-71450IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.6021550IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.3E-121649IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166721.79681125IPR014977WRC domain
PfamPF088792.2E-1982120IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MKALIASIPD GAGALFTAMQ LQELEQQSRV YQYMAARVPV PTHLVFPIWK SVTGASFEGA  60
QKYPTLMGLA TLCLDFGKDP EPEPGRCRRT DGKKWRCWRS TIPNEKYCQR HMHRGRKRPV  120
QLVVEDDEPD SASGSKTTPG KADDKNASNK KLTVAARAAV EST
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957654.11e-108PREDICTED: growth-regulating factor 11-like
SwissprotQ6AWX81e-104GRF11_ORYSJ; Growth-regulating factor 11
TrEMBLK3ZW281e-108K3ZW28_SETIT; Uncharacterized protein
STRINGSi030809m1e-108(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67353152
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.13e-31growth-regulating factor 5